Lineage for d1ahje_ (1ahj E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676053Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1676054Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 1676055Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 1676066Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 1676067Species Rhodococcus erythropolis [TaxId:1833] [56212] (3 PDB entries)
    also Rhodococcus sp. R312
  8. 1676073Domain d1ahje_: 1ahj E: [41776]
    Other proteins in same PDB: d1ahjb_, d1ahjd_, d1ahjf_, d1ahjh_
    complexed with fe

Details for d1ahje_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase
PDB Compounds: (E:) nitrile hydratase (subunit alpha)

SCOPe Domain Sequences for d1ahje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahje_ d.149.1.1 (E:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvptv

SCOPe Domain Coordinates for d1ahje_:

Click to download the PDB-style file with coordinates for d1ahje_.
(The format of our PDB-style files is described here.)

Timeline for d1ahje_: