Lineage for d1c4zb_ (1c4z B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735637Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 735638Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (1 family) (S)
  5. 735639Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (2 proteins)
  6. 735640Protein Ubiquitin-protein ligase E3a (E6ap) [56206] (1 species)
  7. 735641Species Human (Homo sapiens) [TaxId:9606] [56207] (2 PDB entries)
  8. 735643Domain d1c4zb_: 1c4z B: [41767]
    Other proteins in same PDB: d1c4zd_

Details for d1c4zb_

PDB Entry: 1c4z (more details), 2.6 Å

PDB Description: structure of an e6ap-ubch7 complex: insights into the ubiquitination pathway
PDB Compounds: (B:) ubiquitin-protein ligase e3a

SCOP Domain Sequences for d1c4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4zb_ d.148.1.1 (B:) Ubiquitin-protein ligase E3a (E6ap) {Human (Homo sapiens) [TaxId: 9606]}
npylrlkvrrdhiiddalvrlemiamenpadlkkqlyvefegeqgvdeggvskeffqlvv
eeifnpdigmftydestklfwfnpssfetegqftligivlglaiynncildvhfpmvvyr
klmgkkgtfrdlgdshpvlyqslkdlleyegnveddmmitfqisqtdlfgnpmmydlken
gdkipitnenrkefvnlysdyilnksvekqfkafrrgfhmvtnesplkylfrpeeielli
cgsrnldfqaleetteydggytrdsvlirefweivhsftdeqkrlflqfttgtdrapvgg
lgklkmiiakngpdterlptshtcfnvlllpeysskeklkerllkaitya

SCOP Domain Coordinates for d1c4zb_:

Click to download the PDB-style file with coordinates for d1c4zb_.
(The format of our PDB-style files is described here.)

Timeline for d1c4zb_: