Lineage for d1mbt_2 (1mbt 201-342)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.146: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56193] (1 superfamily) Superfamily d.146.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56194] (1 family) 
Family d.146.1.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56195] (1 protein) Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56196] (2 species) Species Escherichia coli [TaxId:562] [56197] (4 PDB entries) 
Domain d1mbt_2: 1mbt 201-342 [41764]
Other proteins in same PDB: d1mbt_1
Details for d1mbt_2
PDB Entry: 1mbt (more details), 3 Å
PDB Description: oxidoreductase
SCOP Domain Sequences for d1mbt_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbt_2 d.146.1.1 (201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli}
vtpqqvfnavchmrttklpdpkvngnagsffknpvvsaetakallsqfptapnypqadgs
vklaagwlidqcqlkgmqiggaavhrqqalvlinednaksedvvqlahhvrqkvgekfnv
wlepevrfigasgevsavetis
SCOP Domain Coordinates for d1mbt_2:
Click to download the PDB-style file with coordinates for d1mbt_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mbt_2:
- d1mbt_2 first appeared (with stable ids) in SCOP 1.55
- d1mbt_2 appears in SCOP 1.59
- d1mbt_2 appears in the current release, SCOPe 2.08, called d1mbta2
View in 3D
