Lineage for d1uxya2 (1uxy A:201-342)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548193Fold d.146: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56193] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2548194Superfamily d.146.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56194] (2 families) (S)
  5. 2548195Family d.146.1.1: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56195] (1 protein)
  6. 2548196Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain [56196] (2 species)
    N-terminal domain is a FAD-binding domain
  7. 2548197Species Escherichia coli [TaxId:562] [56197] (5 PDB entries)
  8. 2548198Domain d1uxya2: 1uxy A:201-342 [41761]
    Other proteins in same PDB: d1uxya1
    complexed with epu, fad; mutant

Details for d1uxya2

PDB Entry: 1uxy (more details), 1.8 Å

PDB Description: murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine
PDB Compounds: (A:) uridine diphospho-n-acetylenolpyruvylglucosamine reductase

SCOPe Domain Sequences for d1uxya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxya2 d.146.1.1 (A:201-342) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain {Escherichia coli [TaxId: 562]}
vtpqqvfnavchmrttklpdpkvngnagaffknpvvsaetakallsqfptapnypqadgs
vklaagwlidqcqlkgmqiggaavhrqqalvlinednaksedvvqlahhvrqkvgekfnv
wlepevrfigasgevsavetis

SCOPe Domain Coordinates for d1uxya2:

Click to download the PDB-style file with coordinates for d1uxya2.
(The format of our PDB-style files is described here.)

Timeline for d1uxya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uxya1