Lineage for d1fiqb2 (1fiq B:224-414)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675846Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 1675847Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 1675864Domain d1fiqb2: 1fiq B:224-414 [41760]
    Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqc1, d1fiqc2
    complexed with fad, fes, gol, mos, mte, sal

Details for d1fiqb2

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk
PDB Compounds: (B:) xanthine oxidase

SCOPe Domain Sequences for d1fiqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqb2 d.145.1.3 (B:224-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d1fiqb2:

Click to download the PDB-style file with coordinates for d1fiqb2.
(The format of our PDB-style files is described here.)

Timeline for d1fiqb2: