Lineage for d1fo4a6 (1fo4 A:192-414)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223838Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2223878Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 2223879Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 2223886Domain d1fo4a6: 1fo4 A:192-414 [41758]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b5
    complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4a6

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1fo4a6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a6 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d1fo4a6:

Click to download the PDB-style file with coordinates for d1fo4a6.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a6: