Lineage for d1ffuf2 (1ffu F:1-177)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36457Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 36458Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 36503Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (2 proteins)
  6. 36504Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 36505Species Hydrogenophaga pseudoflava [TaxId:47421] [56190] (2 PDB entries)
  8. 36509Domain d1ffuf2: 1ffu F:1-177 [41757]
    Other proteins in same PDB: d1ffua1, d1ffua2, d1ffub1, d1ffub2, d1ffuc1, d1ffud1, d1ffud2, d1ffue1, d1ffue2, d1ffuf1

Details for d1ffuf2

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffuf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffuf2 d.145.1.3 (F:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava}
mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaa

SCOP Domain Coordinates for d1ffuf2:

Click to download the PDB-style file with coordinates for d1ffuf2.
(The format of our PDB-style files is described here.)

Timeline for d1ffuf2: