SCOPe 2.08: Domain d7a6oa_: 7a6o A:

Lineage for d7a6oa_ (7a6o A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53307] (11 PDB entries)

8. Domain d7a6oa_: 7a6o A: [417535]
   Other proteins in same PDB: d7a6ob_
   automated match to d1auqa_
   complexed with so4

Details for d7a6oa_

PDB Entry: 7a6o, 2.12 Å

PDB Description: crystal structure of the complex of the recombinant von willebrand factor aim-a1 domain and vhh81 at 2.1 angstrom resolution

PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d7a6oa_:

Sequence; same for both SEQRES and ATOM records:

>d7a6oa_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
isepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavvey
hdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasria
lllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvls
svdeleqqrdeivsylcdlapeapp

Timeline for d7a6oa_:

• d7a6oa_ is new in SCOPe 2.08-stable