Lineage for d1qj2c2 (1qj2 C:1-177)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138297Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 138298Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 138349Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)
  6. 138350Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 138356Species Pseudomonas carboxydovorans [56189] (1 PDB entry)
  8. 138357Domain d1qj2c2: 1qj2 C:1-177 [41752]
    Other proteins in same PDB: d1qj2a1, d1qj2a2, d1qj2b1, d1qj2b2, d1qj2c1, d1qj2g1, d1qj2g2, d1qj2h1, d1qj2h2, d1qj2i1

Details for d1qj2c2

PDB Entry: 1qj2 (more details), 2.2 Å

PDB Description: co dehydrogenase from oligotropha carboxidovorans

SCOP Domain Sequences for d1qj2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qj2c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Pseudomonas carboxydovorans}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOP Domain Coordinates for d1qj2c2:

Click to download the PDB-style file with coordinates for d1qj2c2.
(The format of our PDB-style files is described here.)

Timeline for d1qj2c2: