Lineage for d1mbb_1 (1mbb 3-200)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.145: FAD-binding domain [56175] (1 superfamily) Superfamily d.145.1: FAD-binding domain [56176] (3 families) 
Family d.145.1.2: Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56184] (1 protein) Protein Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain [56185] (1 species) Species Escherichia coli [TaxId:562] [56186] (4 PDB entries) 
Domain d1mbb_1: 1mbb 3-200 [41750]
Other proteins in same PDB: d1mbb_2
Details for d1mbb_1
PDB Entry: 1mbb (more details), 2.3 Å
PDB Description: oxidoreductase
SCOP Domain Sequences for d1mbb_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mbb_1 d.145.1.2 (3-200) Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain {Escherichia coli}
hslkpwntfgidhnaqhivcaedeqqllnawqyataegqpvlilgegsnvlfledyrgtv
iinrikgieihdepdawylhvgagenwhrlvkytlqegmpglenlalipgcvgsspiqni
gaygvelqrvcayvdsvelatgkqvrltakecrfgyrdsifkheyqdrfaivavglrlpk
ewqpvltygdltrldptt
SCOP Domain Coordinates for d1mbb_1:
Click to download the PDB-style file with coordinates for d1mbb_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mbb_1:
- d1mbb_1 appears in SCOP 1.57
- d1mbb_1 appears in the current release, SCOPe 2.08, called d1mbba1
View in 3D
