Lineage for d1diia2 (1dii A:7-242)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875232Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins)
  6. 875248Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
    the other subunit is a short-chain cytochrome c
  7. 875249Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries)
  8. 875255Domain d1diia2: 1dii A:7-242 [41744]
    Other proteins in same PDB: d1diia1, d1diib1, d1diic_, d1diid_

Details for d1diia2

PDB Entry: 1dii (more details), 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution
PDB Compounds: (A:) p-cresol methylhydroxylase

SCOP Domain Sequences for d1diia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diia2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOP Domain Coordinates for d1diia2:

Click to download the PDB-style file with coordinates for d1diia2.
(The format of our PDB-style files is described here.)

Timeline for d1diia2: