Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) |
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins) |
Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species) the other subunit is a short-chain cytochrome c |
Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries) |
Domain d1diia2: 1dii A:7-242 [41744] Other proteins in same PDB: d1diia1, d1diib1, d1diic_, d1diid_ |
PDB Entry: 1dii (more details), 2.5 Å
SCOP Domain Sequences for d1diia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diia2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
Timeline for d1diia2:
View in 3D Domains from other chains: (mouse over for more information) d1diib1, d1diib2, d1diic_, d1diid_ |