SCOPe 2.01: Domain d1diqb2: 1diq B:7-242

Lineage for d1diqb2 (1diq B:7-242)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins)

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
   the other subunit is a short-chain cytochrome c

7. Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries)

8. Domain d1diqb2: 1diq B:7-242 [41743]
   Other proteins in same PDB: d1diqa1, d1diqb1, d1diqc_, d1diqd_
   complexed with cl, fad, hem, pcr

Details for d1diqb2

PDB Entry: 1diq, 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

PDB Compounds: (B:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diqb2:

Sequence; same for both SEQRES and ATOM records:

>d1diqb2 d.145.1.1 (B:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

Timeline for d1diqb2:

• d1diqb2 first appeared (with stable ids) in SCOP 1.55
  
• d1diqb2 appears in SCOP 1.75
  
• d1diqb2 appears in SCOPe 2.02
  
• d1diqb2 appears in the current release, SCOPe 2.08