Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Trichobolus zukalii [TaxId:2081540] [420090] (1 PDB entry) |
Domain d6zmva_: 6zmv A: [417397] automated match to d1jfxa_ complexed with gol, so4 |
PDB Entry: 6zmv (more details), 1.4 Å
SCOPe Domain Sequences for d6zmva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zmva_ c.1.8.0 (A:) automated matches {Trichobolus zukalii [TaxId: 2081540]} avpgfdishyqpsvnyagaynsgarfviikategttytdpvfsthytgatkaglirggyh farpasssgsaqadfffkngggwsadgitlpgmldmeygstsschglsqtamvnwisdfv nryktlsgrypmiytgyywwvectgnsnkfattcplvlarysssvgeipggwgyqtiwqf ndkyayggdsdsfngsldrlkalakgt
Timeline for d6zmva_: