Lineage for d6xswi_ (6xsw I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761339Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)
  8. 2761382Domain d6xswi_: 6xsw I: [417160]
    Other proteins in same PDB: d6xswa_, d6xswd_, d6xswg_, d6xswh_
    automated match to d6shgl_
    complexed with ca, nag

Details for d6xswi_

PDB Entry: 6xsw (more details), 2.98 Å

PDB Description: structure of the notch3 nrr in complex with an antibody fab fragment
PDB Compounds: (I:) Anti-N3 Fab Light Chain

SCOPe Domain Sequences for d6xswi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xswi_ b.1.1.0 (I:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspsslsasvgdrvtitckasqnvgnniawyqqkpgkapklliyyasnrytgvps
rfsgsgygtdftltisslqpedfatyycqrlynspftfgggtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d6xswi_:

Click to download the PDB-style file with coordinates for d6xswi_.
(The format of our PDB-style files is described here.)

Timeline for d6xswi_:

  • d6xswi_ is new in SCOPe 2.08-stable