Lineage for d1e7va4 (1e7v A:726-1094)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542186Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (2 proteins)
  6. 2542190Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 2542259Species Pig (Sus scrofa) [TaxId:9823] [56173] (6 PDB entries)
  8. 2542263Domain d1e7va4: 1e7v A:726-1094 [41712]
    Other proteins in same PDB: d1e7va1, d1e7va2, d1e7va3, d1e7va5
    complexed with ly2

Details for d1e7va4

PDB Entry: 1e7v (more details), 2.4 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1e7va4:

Sequence, based on SEQRES records: (download)

>d1e7va4 d.144.1.4 (A:726-1094) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa) [TaxId: 9823]}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfn
wflhlvlgi

Sequence, based on observed residues (ATOM records): (download)

>d1e7va4 d.144.1.4 (A:726-1094) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa) [TaxId: 9823]}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghinkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmml
mtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgi

SCOPe Domain Coordinates for d1e7va4:

Click to download the PDB-style file with coordinates for d1e7va4.
(The format of our PDB-style files is described here.)

Timeline for d1e7va4: