Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins) members organised in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (1 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56167] (6 PDB entries) |
Domain d1fpub_: 1fpu B: [41707] complexed with prc |
PDB Entry: 1fpu (more details), 2.4 Å
SCOP Domain Sequences for d1fpub_:
Sequence, based on SEQRES records: (download)
>d1fpub_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)} mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc pekvyelmracwqwnpsdrpsfaeihqafetmfqe
>d1fpub_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)} mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma tqissameylekknfihrdlaarnclvgenhlvkvadfglsrtytahagakfpikwtape slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy elmracwqwnpsdrpsfaeihqafetmfqe
Timeline for d1fpub_: