Lineage for d1fpub1 (1fpu B:229-499)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542346Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 2542360Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries)
  8. 2542369Domain d1fpub1: 1fpu B:229-499 [41707]
    Other proteins in same PDB: d1fpua2, d1fpub2
    complexed with prc

Details for d1fpub1

PDB Entry: 1fpu (more details), 2.4 Å

PDB Description: crystal structure of abl kinase domain in complex with a small molecule inhibitor
PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase abl

SCOPe Domain Sequences for d1fpub1:

Sequence, based on SEQRES records: (download)

>d1fpub1 d.144.1.7 (B:229-499) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqe

Sequence, based on observed residues (ATOM records): (download)

>d1fpub1 d.144.1.7 (B:229-499) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrtytahagakfpikwtapeslay
nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
acwqwnpsdrpsfaeihqafetmfqe

SCOPe Domain Coordinates for d1fpub1:

Click to download the PDB-style file with coordinates for d1fpub1.
(The format of our PDB-style files is described here.)

Timeline for d1fpub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fpub2