Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Insulin receptor [56162] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56163] (8 PDB entries) |
Domain d1ir3a_: 1ir3 A: [41702] complexed with anp, mg; mutant |
PDB Entry: 1ir3 (more details), 1.9 Å
SCOP Domain Sequences for d1ir3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ir3a_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse enk
Timeline for d1ir3a_: