Lineage for d1vr2a_ (1vr2 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 263016Family d.144.1.2: Tyrosine kinase [56150] (15 proteins)
  6. 263101Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
  7. 263102Species Human (Homo sapiens) [TaxId:9606] [56161] (1 PDB entry)
  8. 263103Domain d1vr2a_: 1vr2 A: [41701]
    mutant

Details for d1vr2a_

PDB Entry: 1vr2 (more details), 2.4 Å

PDB Description: human vascular endothelial growth factor receptor 2 (kdr) kinase domain

SCOP Domain Sequences for d1vr2a_:

Sequence, based on SEQRES records: (download)

>d1vr2a_ d.144.1.2 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens)}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana

Sequence, based on observed residues (ATOM records): (download)

>d1vr2a_ d.144.1.2 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens)}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
dfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfdarlplkwma
petifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttp
emyqtmldcwhgepsqrptfselvehlgnllqana

SCOP Domain Coordinates for d1vr2a_:

Click to download the PDB-style file with coordinates for d1vr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1vr2a_: