Lineage for d1fgia_ (1fgi A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36394Family d.144.1.2: Tyrosine kinase [56150] (8 proteins)
  6. 36408Protein Fibroblast growth factor receptor 1 [56158] (1 species)
  7. 36409Species Human (Homo sapiens) [TaxId:9606] [56159] (4 PDB entries)
  8. 36414Domain d1fgia_: 1fgi A: [41697]

Details for d1fgia_

PDB Entry: 1fgi (more details), 2.5 Å

PDB Description: crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1 in complex with su5402 inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1fgia_:

Sequence, based on SEQRES records: (download)

>d1fgia_ d.144.1.2 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens)}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts

Sequence, based on observed residues (ATOM records): (download)

>d1fgia_ d.144.1.2 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens)}
elpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdlsd
lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskd
lvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttn
grlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrm
dkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts

SCOP Domain Coordinates for d1fgia_:

Click to download the PDB-style file with coordinates for d1fgia_.
(The format of our PDB-style files is described here.)

Timeline for d1fgia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fgib_