Lineage for d1agwa_ (1agw A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220746Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1220747Species Human (Homo sapiens) [TaxId:9606] [56159] (9 PDB entries)
  8. 1220756Domain d1agwa_: 1agw A: [41695]
    complexed with su2

Details for d1agwa_

PDB Entry: 1agw (more details), 2.4 Å

PDB Description: crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1 in complex with su4984 inhibitor
PDB Compounds: (A:) fgf receptor 1

SCOPe Domain Sequences for d1agwa_:

Sequence, based on SEQRES records: (download)

>d1agwa_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts

Sequence, based on observed residues (ATOM records): (download)

>d1agwa_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgqvvlaeaiglpnrvtkvavkmlksdatekdlsdlisem
emmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskdlvsca
yqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkttngrlpv
kwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsn
ctnelymmmrdcwhavpsqrptfkqlvedldrivalts

SCOPe Domain Coordinates for d1agwa_:

Click to download the PDB-style file with coordinates for d1agwa_.
(The format of our PDB-style files is described here.)

Timeline for d1agwa_: