Lineage for d1fgkb_ (1fgk B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36394Family d.144.1.2: Tyrosine kinase [56150] (8 proteins)
  6. 36408Protein Fibroblast growth factor receptor 1 [56158] (1 species)
  7. 36409Species Human (Homo sapiens) [TaxId:9606] [56159] (4 PDB entries)
  8. 36411Domain d1fgkb_: 1fgk B: [41694]

Details for d1fgkb_

PDB Entry: 1fgk (more details), 2 Å

PDB Description: crystal structure of the tyrosine kinase domain of fibroblast growth factor receptor 1
PDB Compounds: (B:)

SCOP Domain Sequences for d1fgkb_:

Sequence, based on SEQRES records: (download)

>d1fgkb_ d.144.1.2 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens)}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda
tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg
leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia
dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp
ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival
t

Sequence, based on observed residues (ATOM records): (download)

>d1fgkb_ d.144.1.2 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens)}
seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd
lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl
vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmap
ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel
ymmmrdcwhavpsqrptfkqlvedldrivalt

SCOP Domain Coordinates for d1fgkb_:

Click to download the PDB-style file with coordinates for d1fgkb_.
(The format of our PDB-style files is described here.)

Timeline for d1fgkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fgka_