Lineage for d2ptk_3 (2ptk 249-528)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138202Family d.144.1.2: Tyrosine kinase [56150] (11 proteins)
  6. 138209Protein c-src tyrosine kinase [56155] (2 species)
  7. 138210Species Chicken (Gallus gallus) [TaxId:9031] [56157] (1 PDB entry)
  8. 138211Domain d2ptk_3: 2ptk 249-528 [41692]
    Other proteins in same PDB: d2ptk_1, d2ptk_2

Details for d2ptk_3

PDB Entry: 2ptk (more details), 2.35 Å

PDB Description: chicken src tyrosine kinase

SCOP Domain Sequences for d2ptk_3:

Sequence, based on SEQRES records: (download)

>d2ptk_3 d.144.1.2 (249-528) c-src tyrosine kinase {Chicken (Gallus gallus)}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgnmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglgrliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkdpeerptfeylqafledyftstepqyq

Sequence, based on observed residues (ATOM records): (download)

>d2ptk_3 d.144.1.2 (249-528) c-src tyrosine kinase {Chicken (Gallus gallus)}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkppeaflqeaq
vmkklrheklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqias
gmayvermnyvhrdlraanilvgenlvckvadfglfpikwtapeaalygrftiksdvwsf
gilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerpt
feylqafledyftstepqyq

SCOP Domain Coordinates for d2ptk_3:

Click to download the PDB-style file with coordinates for d2ptk_3.
(The format of our PDB-style files is described here.)

Timeline for d2ptk_3: