SCOP 1.63: Domain d3lck__: 3lck -

Lineage for d3lck__ (3lck -)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.2: Tyrosine kinase [56150] (15 proteins)

6. Protein Lymphocyte kinase (lck) [56153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries)

8. Domain d3lck__: 3lck - [41686]
   complexed with so4

Details for d3lck__

PDB Entry: 3lck, 1.7 Å

PDB Description: the kinase domain of human lymphocyte kinase (lck), activated form (auto-phosphorylated on tyr394)

SCOP Domain Sequences for d3lck__:

Sequence; same for both SEQRES and ATOM records:

>d3lck__ d.144.1.2 (-) Lymphocyte kinase (lck) {Human (Homo sapiens)}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat

Timeline for d3lck__:

• d3lck__ first appeared (with stable ids) in SCOP 1.55
  
• d3lck__ appears in SCOP 1.61
  
• d3lck__ appears in SCOP 1.65
  
• d3lck__ appears in the current release, SCOPe 2.08, called d3lcka_