Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries) |
Domain d2hckb3: 2hck B:249-531 [41684] Other proteins in same PDB: d2hcka1, d2hcka2, d2hckb1, d2hckb2 SH2 domain- and SH3 domain-binding regulatory tails are included |
PDB Entry: 2hck (more details), 3 Å
SCOP Domain Sequences for d2hckb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hckb3 d.144.1.7 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw knrpeerptfeyiqsvlddfytatesqyqqqp
Timeline for d2hckb3: