SCOP 1.71: Domain d2hcka3: 2hck A:249-531

Lineage for d2hcka3 (2hck A:249-531)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries)

8. Domain d2hcka3: 2hck A:249-531 [41683]
   Other proteins in same PDB: d2hcka1, d2hcka2, d2hckb1, d2hckb2

Details for d2hcka3

PDB Entry: 2hck, 3 Å

PDB Description: src family kinase hck-quercetin complex

SCOP Domain Sequences for d2hcka3:

Sequence; same for both SEQRES and ATOM records:

>d2hcka3 d.144.1.7 (A:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf
tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw
knrpeerptfeyiqsvlddfytatesqyqqqp

Timeline for d2hcka3:

• d2hcka3 first appeared (with stable ids) in SCOP 1.55
  
• d2hcka3 appears in SCOP 1.69
  
• d2hcka3 appears in SCOP 1.73
  
• d2hcka3 appears in the current release, SCOPe 2.08