Lineage for d1ad5b3 (1ad5 B:249-531)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419513Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 419514Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries)
  8. 419517Domain d1ad5b3: 1ad5 B:249-531 [41682]
    Other proteins in same PDB: d1ad5a1, d1ad5a2, d1ad5b1, d1ad5b2
    complexed with anp, ca

Details for d1ad5b3

PDB Entry: 1ad5 (more details), 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex

SCOP Domain Sequences for d1ad5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad5b3 d.144.1.7 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf
tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw
knrpeerptfeyiqsvlddfytatesqyqqqp

SCOP Domain Coordinates for d1ad5b3:

Click to download the PDB-style file with coordinates for d1ad5b3.
(The format of our PDB-style files is described here.)

Timeline for d1ad5b3: