Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.2: Tyrosine kinase [56150] (15 proteins) |
Protein Haemopoetic cell kinase Hck [56151] (1 species) member of Src family |
Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries) |
Domain d1ad5b3: 1ad5 B:249-531 [41682] Other proteins in same PDB: d1ad5a1, d1ad5a2, d1ad5b1, d1ad5b2 complexed with anp, ca |
PDB Entry: 1ad5 (more details), 2.6 Å
SCOP Domain Sequences for d1ad5b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad5b3 d.144.1.2 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw knrpeerptfeyiqsvlddfytatesqyqqqp
Timeline for d1ad5b3: