Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56152] (4 PDB entries) |
Domain d1qcfa3: 1qcf A:249-531 [41680] Other proteins in same PDB: d1qcfa1, d1qcfa2 SH2 domain- and SH3 domain-binding regulatory tails are included complexed with pp1 |
PDB Entry: 1qcf (more details), 2 Å
SCOPe Domain Sequences for d1qcfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcfa3 d.144.1.7 (A:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip
Timeline for d1qcfa3: