SCOPe 2.08: Domain d1qcfa3: 1qcf A:249-531

Lineage for d1qcfa3 (1qcf A:249-531)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (25 PDB entries)

8. Domain d1qcfa3: 1qcf A:249-531 [41680]
   Other proteins in same PDB: d1qcfa1, d1qcfa2
   SH2 domain- and SH3 domain-binding regulatory tails are included
   complexed with pp1

Details for d1qcfa3

PDB Entry: 1qcf, 2 Å

PDB Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor

PDB Compounds: (A:) haematopoetic cell kinase (hck)

SCOPe Domain Sequences for d1qcfa3:

Sequence; same for both SEQRES and ATOM records:

>d1qcfa3 d.144.1.7 (A:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Timeline for d1qcfa3:

• d1qcfa3 first appeared (with stable ids) in SCOP 1.55
  
• d1qcfa3 appears in SCOPe 2.07