Lineage for d1howa_ (1how A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84395Family d.144.1.1: Serine/threonin kinases [56113] (16 proteins)
  6. 84514Protein Sky1p [56148] (1 species)
  7. 84515Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (1 PDB entry)
  8. 84516Domain d1howa_: 1how A: [41679]

Details for d1howa_

PDB Entry: 1how (more details), 2.1 Å

PDB Description: the x-ray crystal structure of sky1p, an sr protein kinase in yeast

SCOP Domain Sequences for d1howa_:

Sequence, based on SEQRES records: (download)

>d1howa_ d.144.1.1 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae)}
fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkd
ddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskde
akeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfee
vr

Sequence, based on observed residues (ATOM records): (download)

>d1howa_ d.144.1.1 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae)}
fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei
kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr
gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac
wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepddddhiaqi
iellgelpsyllrngkytrtffsklkfwpledvltekykfskdeakeisdflspmlqldp
rkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr

SCOP Domain Coordinates for d1howa_:

Click to download the PDB-style file with coordinates for d1howa_.
(The format of our PDB-style files is described here.)

Timeline for d1howa_: