Lineage for d1f3md_ (1f3m D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735356Protein pak1 [56146] (1 species)
    OPK group; PAK/STE20 subfamily; serine/threonine kinase
  7. 735357Species Human (Homo sapiens) [TaxId:9606] [56147] (2 PDB entries)
  8. 735360Domain d1f3md_: 1f3m D: [41678]
    Other proteins in same PDB: d1f3ma_, d1f3mb_
    complexed with iod; mutant

Details for d1f3md_

PDB Entry: 1f3m (more details), 2.3 Å

PDB Description: crystal structure of human serine/threonine kinase pak1
PDB Compounds: (D:) serine/threonine-protein kinase pak-alpha

SCOP Domain Sequences for d1f3md_:

Sequence, based on SEQRES records: (download)

>d1f3md_ d.144.1.7 (D:) pak1 {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk

Sequence, based on observed residues (ATOM records): (download)

>d1f3md_ d.144.1.7 (D:) pak1 {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpgtpywmapevvt
rkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifrdf
lnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk

SCOP Domain Coordinates for d1f3md_:

Click to download the PDB-style file with coordinates for d1f3md_.
(The format of our PDB-style files is described here.)

Timeline for d1f3md_: