Lineage for d1f3md_ (1f3m D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36362Protein pak1 [56146] (1 species)
  7. 36363Species Human (Homo sapiens) [TaxId:9606] [56147] (1 PDB entry)
  8. 36365Domain d1f3md_: 1f3m D: [41678]
    Other proteins in same PDB: d1f3ma_, d1f3mb_

Details for d1f3md_

PDB Entry: 1f3m (more details), 2.3 Å

PDB Description: crystal structure of human serine/threonine kinase pak1

SCOP Domain Sequences for d1f3md_:

Sequence, based on SEQRES records: (download)

>d1f3md_ d.144.1.1 (D:) pak1 {Human (Homo sapiens)}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk

Sequence, based on observed residues (ATOM records): (download)

>d1f3md_ d.144.1.1 (D:) pak1 {Human (Homo sapiens)}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpgtpywmapevvt
rkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifrdf
lnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk

SCOP Domain Coordinates for d1f3md_:

Click to download the PDB-style file with coordinates for d1f3md_.
(The format of our PDB-style files is described here.)

Timeline for d1f3md_: