Lineage for d1f3mc_ (1f3m C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612338Protein pak1 [56146] (1 species)
    OPK group; PAK/STE20 subfamily; serine/threonine kinase
  7. 612339Species Human (Homo sapiens) [TaxId:9606] [56147] (1 PDB entry)
  8. 612340Domain d1f3mc_: 1f3m C: [41677]
    Other proteins in same PDB: d1f3ma_, d1f3mb_

Details for d1f3mc_

PDB Entry: 1f3m (more details), 2.3 Å

PDB Description: crystal structure of human serine/threonine kinase pak1

SCOP Domain Sequences for d1f3mc_:

Sequence, based on SEQRES records: (download)

>d1f3mc_ d.144.1.7 (C:) pak1 {Human (Homo sapiens)}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk

Sequence, based on observed residues (ATOM records): (download)

>d1f3mc_ d.144.1.7 (C:) pak1 {Human (Homo sapiens)}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqittmvgtpywmapev
vtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpeklsaifr
dflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatk

SCOP Domain Coordinates for d1f3mc_:

Click to download the PDB-style file with coordinates for d1f3mc_.
(The format of our PDB-style files is described here.)

Timeline for d1f3mc_: