Lineage for d1b6cf_ (1b6c F:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36388Protein Type I TGF-beta recetor R4 [56144] (1 species)
  7. 36389Species Human (Homo sapiens) [TaxId:9606] [56145] (1 PDB entry)
  8. 36392Domain d1b6cf_: 1b6c F: [41675]
    Other proteins in same PDB: d1b6ca_, d1b6cc_, d1b6ce_, d1b6cg_

Details for d1b6cf_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12

SCOP Domain Sequences for d1b6cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6cf_ d.144.1.1 (F:) Type I TGF-beta recetor R4 {Human (Homo sapiens)}
ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
wyangaarltalrikktlsqlsqqeg

SCOP Domain Coordinates for d1b6cf_:

Click to download the PDB-style file with coordinates for d1b6cf_.
(The format of our PDB-style files is described here.)

Timeline for d1b6cf_: