Lineage for d1b6cb_ (1b6c B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138191Protein Type I TGF-beta receptor R4 [56144] (1 species)
  7. 138192Species Human (Homo sapiens) [TaxId:9606] [56145] (2 PDB entries)
  8. 138193Domain d1b6cb_: 1b6c B: [41673]
    Other proteins in same PDB: d1b6ca_, d1b6cc_, d1b6ce_, d1b6cg_

Details for d1b6cb_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12

SCOP Domain Sequences for d1b6cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6cb_ d.144.1.1 (B:) Type I TGF-beta receptor R4 {Human (Homo sapiens)}
ttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeevavkif
ssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfdylnr
ytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtcciadlgl
avrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarr
csiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrec
wyangaarltalrikktlsqlsqqeg

SCOP Domain Coordinates for d1b6cb_:

Click to download the PDB-style file with coordinates for d1b6cb_.
(The format of our PDB-style files is described here.)

Timeline for d1b6cb_: