SCOP 1.59: Domain d1ds5c_: 1ds5 C:

Lineage for d1ds5c_ (1ds5 C:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)

5. Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)

6. Protein Protein kinase CK2, alpha subunit [56142] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [56143] (5 PDB entries)

8. Domain d1ds5c_: 1ds5 C: [41671]

Details for d1ds5c_

PDB Entry: 1ds5, 3.16 Å

PDB Description: dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.

SCOP Domain Sequences for d1ds5c_:

Sequence; same for both SEQRES and ATOM records:

>d1ds5c_ d.144.1.1 (C:) Protein kinase CK2, alpha subunit {Maize (Zea mays)}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

Timeline for d1ds5c_:

• d1ds5c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ds5c_ appears in SCOP 1.57
  
• d1ds5c_ appears in SCOP 1.61
  
• d1ds5c_ appears in the current release, SCOPe 2.08