Lineage for d1ds5a_ (1ds5 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138168Protein Protein kinase CK2, alpha subunit [56142] (1 species)
  7. 138169Species Maize (Zea mays) [TaxId:4577] [56143] (5 PDB entries)
  8. 138174Domain d1ds5a_: 1ds5 A: [41669]

Details for d1ds5a_

PDB Entry: 1ds5 (more details), 3.16 Å

PDB Description: dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.

SCOP Domain Sequences for d1ds5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds5a_ d.144.1.1 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays)}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

SCOP Domain Coordinates for d1ds5a_:

Click to download the PDB-style file with coordinates for d1ds5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ds5a_: