Lineage for d2csna_ (2csn A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220295Protein Casein kinase-1, CK1 [56139] (3 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 1220296Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries)
  8. 1220298Domain d2csna_: 2csn A: [41665]
    complexed with cki, so4

Details for d2csna_

PDB Entry: 2csn (more details), 2.5 Å

PDB Description: binary complex of casein kinase-1 with cki7
PDB Compounds: (A:) casein kinase-1

SCOPe Domain Sequences for d2csna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll

SCOPe Domain Coordinates for d2csna_:

Click to download the PDB-style file with coordinates for d2csna_.
(The format of our PDB-style files is described here.)

Timeline for d2csna_: