Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Casein kinase-1, CK1 [56139] (4 species) OPK group; CKI subfamily; serine/threonine kinase |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries) |
Domain d1ckjb_: 1ckj B: [41663] complexed with wo4; mutant |
PDB Entry: 1ckj (more details), 2.46 Å
SCOPe Domain Sequences for d1ckjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckjb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml
Timeline for d1ckjb_: