Lineage for d1ckjb_ (1ckj B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138074Protein Casein kinase-1, CK1 [56139] (2 species)
  7. 138080Species Rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries)
  8. 138084Domain d1ckjb_: 1ckj B: [41663]

Details for d1ckjb_

PDB Entry: 1ckj (more details), 2.46 Å

PDB Description: casein kinase i delta truncation mutant containing residues 1-317 complex with bound tungstate

SCOP Domain Sequences for d1ckjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckjb_ d.144.1.1 (B:) Casein kinase-1, CK1 {Rat (Rattus norvegicus)}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

SCOP Domain Coordinates for d1ckjb_:

Click to download the PDB-style file with coordinates for d1ckjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ckjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ckja_