Lineage for d4erk__ (4erk -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins) 
Protein MAP kinase Erk2 [56134] (2 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [56136] (5 PDB entries) 
Domain d4erk__: 4erk - [41656]
Details for d4erk__
PDB Entry: 4erk (more details), 2.2 Å
PDB Description: the complex structure of the map kinase erk2/olomoucine
SCOP Domain Sequences for d4erk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4erk__ d.144.1.1 (-) MAP kinase Erk2 {Rat (Rattus norvegicus)}
aagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqr
tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg
SCOP Domain Coordinates for d4erk__:
Click to download the PDB-style file with coordinates for d4erk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4erk__:
- d4erk__ first appeared (with stable ids) in SCOP 1.55
- d4erk__ appears in SCOP 1.57
- d4erk__ appears in SCOP 1.61
- d4erk__ appears in the current release, SCOPe 2.08, called d4erka_
View in 3D