Lineage for d3erka_ (3erk A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220991Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1220994Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (14 PDB entries)
  8. 1221001Domain d3erka_: 3erk A: [41654]
    complexed with sb4

Details for d3erka_

PDB Entry: 3erk (more details), 2.1 Å

PDB Description: the complex structure of the map kinase erk2/sb220025
PDB Compounds: (A:) extracellular regulated kinase 2

SCOPe Domain Sequences for d3erka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erka_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqr
tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

SCOPe Domain Coordinates for d3erka_:

Click to download the PDB-style file with coordinates for d3erka_.
(The format of our PDB-style files is described here.)

Timeline for d3erka_: