Lineage for d1pmea_ (1pme A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434996Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1434997Species Human (Homo sapiens) [TaxId:9606] [56135] (1 PDB entry)
  8. 1434998Domain d1pmea_: 1pme A: [41653]
    complexed with sb2, so4; mutant

Details for d1pmea_

PDB Entry: 1pme (more details), 2 Å

PDB Description: structure of penta mutant human erk2 map kinase complexed with a specific inhibitor of human p38 map kinase
PDB Compounds: (A:) erk2

SCOPe Domain Sequences for d1pmea_:

Sequence, based on SEQRES records: (download)

>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
gqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlreikil
lrfrheniigindiiraptieqmkdvylvthlmgadlykllktqhlsndhicyflyqilr
glkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyra
peimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnci
inlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleq
yydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs

Sequence, based on observed residues (ATOM records): (download)

>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
gqvfdvgprytnlsyigygmvcsaydnvnkvrvaikkispfehqtycqrtlreikillrf
rheniigindiiraptieqmkdvylvthlmgadlykllktqhlsndhicyflyqilrglk
yihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvatrwyrapei
mlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinl
karnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyyd
psdepiaeapflpkeklkelifeetarfqpgyrs

SCOPe Domain Coordinates for d1pmea_:

Click to download the PDB-style file with coordinates for d1pmea_.
(The format of our PDB-style files is described here.)

Timeline for d1pmea_: