Lineage for d1p38a_ (1p38 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735287Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 735332Species Mouse (Mus musculus) [TaxId:10090] [56131] (3 PDB entries)
  8. 735333Domain d1p38a_: 1p38 A: [41650]
    mutant

Details for d1p38a_

PDB Entry: 1p38 (more details), 2.1 Å

PDB Description: the structure of the map kinase p38 at 2.1 angstoms resolution
PDB Compounds: (A:) map kinase p38

SCOP Domain Sequences for d1p38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p38a_ d.144.1.7 (A:) MAP kinase p38 {Mouse (Mus musculus) [TaxId: 10090]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

SCOP Domain Coordinates for d1p38a_:

Click to download the PDB-style file with coordinates for d1p38a_.
(The format of our PDB-style files is described here.)

Timeline for d1p38a_: