Lineage for d1a9ua_ (1a9u A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673363Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1673364Species Human (Homo sapiens) [TaxId:9606] [56130] (162 PDB entries)
  8. 1673492Domain d1a9ua_: 1a9u A: [41646]
    complexed with sb2

Details for d1a9ua_

PDB Entry: 1a9u (more details), 2.5 Å

PDB Description: the complex structure of the map kinase p38/sb203580
PDB Compounds: (A:) map kinase p38

SCOPe Domain Sequences for d1a9ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9ua_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

SCOPe Domain Coordinates for d1a9ua_:

Click to download the PDB-style file with coordinates for d1a9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1a9ua_: