Lineage for d1a9u__ (1a9u -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins) 
Protein MAP kinase p38 [56129] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56130] (7 PDB entries) 
Domain d1a9u__: 1a9u - [41646]
Details for d1a9u__
PDB Entry: 1a9u (more details), 2.5 Å
PDB Description: the complex structure of the map kinase p38/sb203580
SCOP Domain Sequences for d1a9u__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9u__ d.144.1.1 (-) MAP kinase p38 {Human (Homo sapiens)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
SCOP Domain Coordinates for d1a9u__:
Click to download the PDB-style file with coordinates for d1a9u__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a9u__:
- d1a9u__ appears in SCOP 1.57
- d1a9u__ appears in the current release, SCOPe 2.08, called d1a9ua_
View in 3D