Lineage for d1bmka_ (1bmk A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins) 
Protein MAP kinase p38 [56129] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [56130] (7 PDB entries) 
Domain d1bmka_: 1bmk A: [41644]
Details for d1bmka_
PDB Entry: 1bmk (more details), 2.4 Å
PDB Description: the complex structure of the map kinase p38/sb218655
SCOP Domain Sequences for d1bmka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmka_ d.144.1.1 (A:) MAP kinase p38 {Human (Homo sapiens)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
SCOP Domain Coordinates for d1bmka_:
Click to download the PDB-style file with coordinates for d1bmka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bmka_:
- d1bmka_ first appeared (with stable ids) in SCOP 1.55
- d1bmka_ appears in SCOP 1.57
- d1bmka_ appears in SCOP 1.61
- d1bmka_ appears in the current release, SCOPe 2.08
View in 3D