Lineage for d1koaa2 (1koa A:5915-6264)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435479Protein Twitchin, kinase domain [56126] (2 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1435480Species Caenorhabditis elegans, pjk4 [TaxId:6239] [56128] (1 PDB entry)
  8. 1435481Domain d1koaa2: 1koa A:5915-6264 [41642]
    Other proteins in same PDB: d1koaa1

Details for d1koaa2

PDB Entry: 1koa (more details), 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains
PDB Compounds: (A:) twitchin

SCOPe Domain Sequences for d1koaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]}
ydnyvfdiwkqyypqpveikhdhvldhydiheelgtgafgvvhrvteratgnnfaakfvm
tphesdketvrkeiqtmsvlrhptlvnlhdafeddnemvmiyefmsggelfekvadehnk
msedeaveymrqvckglchmhennyvhldlkpenimfttkrsnelklidfgltahldpkq
svkvttgtaefaapevaegkpvgyytdmwsvgvlsyillsglspfggenddetlrnvksc
dwnmddsafsgisedgkdfirkllladpntrmtihqalehpwltpgnapgrdsqipssry
tkirdsiktkydawpeplpplgrisnysslrkhrpqeysirdafwdrsea

SCOPe Domain Coordinates for d1koaa2:

Click to download the PDB-style file with coordinates for d1koaa2.
(The format of our PDB-style files is described here.)

Timeline for d1koaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1koaa1