Lineage for d1koa_2 (1koa 5915-6264)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84395Family d.144.1.1: Serine/threonin kinases [56113] (16 proteins)
  6. 84521Protein Twitchin, kinase domain [56126] (2 species)
  7. 84522Species Caenorhabditis elegans, pjk4 [TaxId:6239] [56128] (1 PDB entry)
  8. 84523Domain d1koa_2: 1koa 5915-6264 [41642]
    Other proteins in same PDB: d1koa_1

Details for d1koa_2

PDB Entry: 1koa (more details), 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains

SCOP Domain Sequences for d1koa_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1koa_2 d.144.1.1 (5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4}
ydnyvfdiwkqyypqpveikhdhvldhydiheelgtgafgvvhrvteratgnnfaakfvm
tphesdketvrkeiqtmsvlrhptlvnlhdafeddnemvmiyefmsggelfekvadehnk
msedeaveymrqvckglchmhennyvhldlkpenimfttkrsnelklidfgltahldpkq
svkvttgtaefaapevaegkpvgyytdmwsvgvlsyillsglspfggenddetlrnvksc
dwnmddsafsgisedgkdfirkllladpntrmtihqalehpwltpgnapgrdsqipssry
tkirdsiktkydawpeplpplgrisnysslrkhrpqeysirdafwdrsea

SCOP Domain Coordinates for d1koa_2:

Click to download the PDB-style file with coordinates for d1koa_2.
(The format of our PDB-style files is described here.)

Timeline for d1koa_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1koa_1